Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502268

erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRO2801, RD, SC
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502268
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ERMAP antibody: synthetic peptide directed towards the middle region of human ERMAP
Sequence RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSE DQRCVRLGDR
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Guinea pig : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against ERMAP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ERMAP
Background ERMAP is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in the gene encoding ERMAP protein are responsible for the Scianna/Radin blood group system. The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 52kDa
Gene ID 114625
NCBI Accession NP_061008, NM_018538
UniProt Q96PL5
Research Area Stem Cells, Hematopoietic Progenitors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ERMAP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Flegel, Chen, Reid et al.: "SCER and SCAN: two novel high-prevalence antigens in the Scianna blood group system." in: Transfusion, Vol. 45, Issue 12, pp. 1940-4, 2005 (PubMed).

Alternatives for antigen "erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP)", type "Antibodies"
Hosts (28), (8)
Reactivities (34), (18), (18), (1)
Applications (20), (17), (11), (10), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon