TraB Domain Containing (TRABD) (Middle Region) antibody

Details for Product No. ABIN502283
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LP6054, PP2447, AL023039, 5730502D15Rik, RGD1310875, fb66c10, zgc:66436, wu:fb66c10, wu:fi04e11, TRABD
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(4), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(5), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (1)
Pubmed 1 reference available
Catalog no. ABIN502283
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRABD
Sequence LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTI VSERDVYLTY
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against TRABD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRABD
Background The function of TRABD remains unknown.
Molecular Weight 42 kDa
Gene ID 80305
NCBI Accession NM_025204, NP_079480
UniProt Q9H4I3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 376 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TraB Domain Containing (TRABD) (Middle Region) antibody WB Suggested Anti-TRABD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Collins, Goward, Cole et al.: "Reevaluating human gene annotation: a second-generation analysis of chromosome 22." in: Genome research, Vol. 13, Issue 1, pp. 27-36, 2003 (PubMed).

Hosts (5), (1)
Reactivities (4), (1), (1), (1), (1), (1), (1)
Applications (6), (1)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top