Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Myosin Regulatory Light Chain Interacting Protein (MYLIP) antibody

Antigen

Myosin Regulatory Light Chain Interacting Protein (MYLIP)

Synonyms MIR, IDOL, Mir, MGC11702, 9430057C20Rik, mylip, zgc:55987, wu:fj36b03, MYLIP, MGC159760, mir
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502354
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MYLIP
Gene ID MYLIP
UniProt Q8WY64
Immunogen The immunogen for anti-MYLIP antibody: synthetic peptide directed towards the middle region of human MYLIP
Sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTF CPCGHTVCCE
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MYLIP antibody concentration is 1 mg/ml.
Description The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowthThe ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.
Characteristics Antigen Size: 445 amino acids
Molecular Weight 50kDa

Application Details

Application Notes WB Suggested Anti-MYLIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: SK-MEL-2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Proteolysis / Ubiquitin, Cytoskeleton
Restrictions For Research Use only

Publications

Product Ohmura-Hoshino, Matsuki, Aoki et al.: "Inhibition of MHC class II expression and immune responses by c-MIR." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 177, Issue 1, pp. 341-54, 2006 (PubMed).

Alternatives

Alternatives for antigen "Myosin Regulatory Light Chain Interacting Protein (MYLIP)", type "Antibodies"
Hosts Rabbit (30), Goat (1)
Reactivities Human (30), Mouse (Murine) (23), Rat (Rattus) (23), Cow (Bovine) (19), Dog (Canine) (19), Horse (Equine) (18), Pig (Porcine) (18), Rabbit (18), Cat (Feline) (1), Chicken (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (16), ELISA (14), Immunohistochemistry (IHC) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes Internal Region (4), Center (1)