Hect Domain and RLD 4 (HERC4) antibody

Antigen: Hect Domain and RLD 4 (HERC4)

Synonyms: KIAA1593, DKFZp564G092, mKIAA1593, 1700056O17Rik, 4921531D01Rik, 9530080M15Rik, MGC81587, MGC132293, HERC4, MGC142977

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502371

Additional Information

Alternative name: HERC4

Gene ID: HERC4

UniProt: Q5GLZ8

Immunogen: The immunogen for anti-HERC4 antibody: synthetic peptide directed towards the middle region of human HERC4

Sequence: LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQ AIDHNEGFSL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HERC4 antibody concentration is 1 mg/ml.

Description: HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transf

Characteristics: Antigen Size: 1057 amino acids

Molecular Weight: 118kDa

Application Details

Application Notes: WB Suggested Anti-HERC4 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin

Restrictions: For Research Use only

Images

WB Suggested Anti-HERC4 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysate

Publications

Product: Hochrainer, Mayer, Baranyi et al.: "The human HERC family of ubiquitin ligases: novel members, genomic organization, expression profiling, and evolutionary aspects." in: Genomics, Vol. 85, Issue 2, pp. 153-64, 2005 (PubMed).