LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3) antibody

Antigen: LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN502373

Additional Information

Alternative name: LONRF3

Gene ID: LONRF3

UniProt: Q496Y0

Immunogen: The immunogen for anti-LONRF3 antibody: synthetic peptide directed towards the N terminal of human LONRF3

Sequence: QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRER QVEAALLKYN

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-LONRF3 antibody concentration is 1 mg/ml.

Description: LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear. The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.

Characteristics: Antigen Size: 759 amino acids

Molecular Weight: 84kDa

Application Details

Application Notes: WB Suggested Anti-LONRF3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors, Metabolism, Amino Acids

Restrictions: For Research Use only

Images

WB Suggested Anti-LONRF3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Publications

Product: Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).