HECT Domain Containing 2 (HECTD2) antibody

Antigen: HECT Domain Containing 2 (HECTD2)

Synonyms: FLJ16050, AW212605, 4921524L07, A630025O09Rik, HECTD2, hmm77879, DKFZp459J1430

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN502394

Additional Information

Alternative name: HECTD2

Gene ID: HECTD2

UniProt: Q5U5R9

Immunogen: The immunogen for anti-HECTD2 antibody: synthetic peptide directed towards the middle region of human HECTD2

Sequence: ALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLT IKYFWDVVLG

Cross-Reactivity: Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HECTD2 antibody concentration is 1 mg/ml.

Description: HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Characteristics: Antigen Size: 776 amino acids

Molecular Weight: 88kDa

Application Details

Application Notes: WB Suggested Anti-HECTD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin

Restrictions: For Research Use only

Images

WB Suggested Anti-HECTD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Publications

Product: Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).