Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1) antibody

Antigen

Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken, Fruit Fly (Drosophila melanogaster), Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502435
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SLC6A1
Gene ID SLC6A1
UniProt P30531
Immunogen The immunogen for anti-SLC6A1 antibody: synthetic peptide directed towards the middle region of human SLC6A1
Sequence CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGL AFLAYPEAVT
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SLC6A1 antibody concentration is 1 mg/ml.
Description SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.
Characteristics Antigen Size: 599 amino acids
Molecular Weight 67kDa

Application Details

Application Notes WB Suggested Anti-SLC6A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Gotlib, Joormann, Minor et al.: "HPA axis reactivity: a mechanism underlying the associations among 5-HTTLPR, stress, and depression." in: Biological psychiatry, Vol. 63, Issue 9, pp. 847-51, 2008 (PubMed).

Alternatives

Alternatives for antigen "Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1)", type "Antibodies"
Hosts Rabbit (30)
Reactivities Human (23), Rat (Rattus) (22), Mouse (Murine) (19), Dog (Canine) (18), Guinea Pig (18), Pig (Porcine) (18)
Applications Immunofluorescence (IF) (17), Flow Cytometry (FACS) (15), Western Blotting (WB) (15), ELISA (7), Immunohistochemistry (IHC) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (3), Internal Region (2), N-Term (2), Middle Region (1)