SLC6A1 antibody (N-Term)
-
- Target See all SLC6A1 (GAT1) Antibodies
- SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))
-
Binding Specificity
- AA 23-54, N-Term
-
Reactivity
- Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC6A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Sodium- and chloride-dependent GABA transporter 1(SLC6A1) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- ANDKPKTLVV KVQKKAADLP DRDTWKGRFD FL
- Cross-Reactivity (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Characteristics
-
Rabbit IgG polyclonal antibody for Sodium- and chloride-dependent GABA transporter 1(SLC6A1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: solute carrier family 6 member 1
Protein Name: Sodium- and chloride-dependent GABA transporter 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human SLC6A1 (23-54aa ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL), different from the related mouse and rat sequences by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product GAT1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))
- Alternative Name
- SLC6A1 (GAT1 Products)
- Synonyms
- GABATHG antibody, GABATR antibody, GAT1 antibody, A730043E01 antibody, GAT-1 antibody, Gabt antibody, Gabt1 antibody, Gat1 antibody, XT-1 antibody, Xtrp1 antibody, si:ch211-280e18.1 antibody, si:dkey-164m14.1 antibody, slc6a1 antibody, solute carrier family 6 member 1 antibody, solute carrier family 6 (neurotransmitter transporter, GABA), member 1 antibody, solute carrier family 6 (neurotransmitter transporter, GABA), member 1, like antibody, GABA neurotransmitter transporter 1 antibody, SLC6A1 antibody, Slc6a1 antibody, slc6a1l antibody, slc6a1 antibody
- Background
-
GABA transporter 1 (GAT1), also known as sodium- and chloride-dependent GABA transporter 1, is a protein that in humans is encoded by the SLC6A1 gene. GABA Transporter 1 uses Na+ and Cl- to create a gradient, which removes or adds GABA to extracellular spaces in the cerebrum and cerebellum. The stoichiometry for GABA Transporter 1 is 2 Na+: 1 Cl-: 1 GABA. The activity of GAT1 is largely dependent on the presence of Na+, while Cl- assists by increasing the ability for GAT-1 to uptake GABA.
Synonyms: Sodium- and chloride-dependent GABA transporter 1, GAT-1, Solute carrier family 6 member 1, SLC6A1, GABATR, GABT1, GAT1 - Gene ID
- 6529
- UniProt
- P30531
-