Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 25, Member 28 (SLC25A28) antibody

Antigen

Solute Carrier Family 25, Member 28 (SLC25A28)
Synonyms MFRN2, MRS4L, MRS3/4, NPD016, DKFZp547C109
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502469
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Solute Carrier Family 25, Member 28 (SLC25A28) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name SLC25A28 / Mitoferrin-2
Gene ID SLC25A28
UniProt Q96A46
Immunogen The immunogen for anti-SLC25A28 antibody: synthetic peptide directed towards the middle region of human SLC25A28
Sequence VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFN PQRRYNPSSH
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SLC25A28 antibody concentration is 1 mg/ml.
Description SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.
Characteristics Antigen Size: 364 amino acids
Molecular Weight 39kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-SLC25A28 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Stomach.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Solute Carrier Family 25, Member 28 (SLC25A28)", type "Antibodies"
Hosts Rabbit (24)
Reactivities Human (22), Mouse (Murine) (19), Rat (Rattus) (18), Cow (Bovine) (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (9), ELISA (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (1), Internal Region (1), N-Term (1)