Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1) antibody

Antigen

Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1)
Synonyms VGAT, Viaat, R75019, CG8394, CG8394.2, DmelCG8394, vGAT, VIAAT, BGT1, Gat1, RNU28927, Vgat, Ci-vGAT, slc32a1, viaat, MGC68938, vgat, xVIAAT, MGC89195
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502472
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name VGAT / SLC32A1
Gene ID SLC32A1
UniProt Q9H598
Immunogen The immunogen for anti-SLC32A1 antibody: synthetic peptide directed towards the N terminal of human SLC32A1
Sequence GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGG HDKPKITAWE
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SLC32A1 antibody concentration is 1 mg/ml.
Description SLC32A1 is involved in the uptake of GABA and glycine into the synaptic vesicles.The protein encoded by this gene is an integral membrane protein involved in gamma-aminobutyric acid (GABA) and glycine uptake into synaptic vesicles. The encoded protein is a member of amino acid/polyamine transporter family II.
Characteristics Antigen Size: 525 amino acids
Molecular Weight 57kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-SLC32A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Transporters
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Hashimoto, Arion, Unger et al.: "Alterations in GABA-related transcriptome in the dorsolateral prefrontal cortex of subjects with schizophrenia." in: Molecular psychiatry, Vol. 13, Issue 2, pp. 147-61, 2008 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1)", type "Antibodies"
Hosts Rabbit (41)
Reactivities Rat (Rattus) (31), Human (28), Mouse (Murine) (22), Cow (Bovine) (20), Dog (Canine) (20), Chicken (18), Horse (Equine) (18), Pig (Porcine) (18), Sheep (Ovine) (18), Monkey (1)
Applications Western Blotting (WB) (22), Immunofluorescence (IF) (20), ELISA (11), Immunohistochemistry (IHC) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Fixed) (IHC (fx)) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes AA 201-300 (18), C-Term (6), N-Term (4)