Proline Rich Gla (G-Carboxyglutamic Acid) 1 (PRRG1) (N-Term) antibody

Details for Product No. ABIN502506
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRGP1, TMG1, 2010007L08Rik, RGD1561320
Epitope
N-Term
(13), (7), (2), (1), (1)
Reactivity
Human
(19), (1), (1), (1)
Host
Rabbit
(17), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (8), (2), (1)
Pubmed 1 reference available
Quantity 50 μg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502506
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PRRG1
Sequence MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEE FCTFEEAREA
Predicted Reactivity Human : 100 %, Dog : 90 %, Mouse : 90 %, Rabbit : 90 %, Rat : 90 %, African clawed frog : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against PRRG1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PRRG1
Background The exact function of PRRG1 remains unknown.
Molecular Weight 25 kDa
Gene ID 5638
NCBI Accession NP_000941, NM_000950
UniProt O14668
Research Area Signaling, Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 218 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proline Rich Gla (G-Carboxyglutamic Acid) 1 (PRRG1) (N-Term) antibody WB Suggested Anti-PRRG1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome. ..." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Validation Images
Did you look for something else?
back to top