Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502506

Proline Rich Gla (G-Carboxyglutamic Acid) 1 (PRRG1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRGP1, 2010007L08Rik, RGD1561320, TMG1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502506
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRRG1 antibody: synthetic peptide directed towards the N terminal of human PRRG1
Sequence MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEE FCTFEEAREA
Predicted Reactivity Human : 100%, Dog : 92%, Mouse : 92%, Rabbit : 92%, Rat : 92%, African clawed frog : 91%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against PRRG1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRRG1
Background The exact function of PRRG1 remains unknown.
Molecular Weight 25kDa
Gene ID 5638
NCBI Accession NP_000941, NM_000950
UniProt O14668
Research Area Signaling, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRRG1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Proline Rich Gla (G-Carboxyglutamic Acid) 1 (PRRG1)", type "Antibodies"
Hosts (9), (2)
Reactivities (8), (1), (1), (1)
Applications (10), (4), (2), (1), (1)
Epitopes (6), (2), (1), (1)
Beacon