Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502510

Microtubule Associated Tumor Suppressor 1 (MTUS1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ATBP, ATIP, ICIS, MP44, MTSG1, AI481402, ATBP135, Atip1, B430010I23Rik, B430305I03Rik, C85752, Cctsg1-440, MD44, mKIAA1288, ATIP4, Atip3b, Mtsg1, fbx27
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502510
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MTUS1 antibody: synthetic peptide directed towards the middle region of human MTUS1
Sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSG SFPSPSISPR
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Pig : 100%, Mouse : 92%, Rat : 92%, Guinea pig : 85%, Rabbit : 85%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against MTUS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MTUS1
Background MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.
Molecular Weight 141kDa
Gene ID 57509
NCBI Accession NP_001001924, NM_001001924
UniProt Q9ULD2
Research Area Cancer, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MTUS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Microtubule Associated Tumor Suppressor 1 (MTUS1)", type "Antibodies"
Hosts (15), (3)
Reactivities (16), (11), (11), (9), (9), (9), (8)
Applications (13), (8), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1)
Beacon