Microtubule Associated Tumor Suppressor 1 (MTUS1) antibody

Antigen: Microtubule Associated Tumor Suppressor 1 (MTUS1)

Synonyms: ATIP, MP44, MTSG1, FLJ14295, KIAA1288, DKFZp586D1519, DKFZp686F20243

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN502510

Additional Information

Alternative name: MTUS1

Gene ID: MTUS1

UniProt: Q9ULD2

Immunogen: The immunogen for anti-MTUS1 antibody: synthetic peptide directed towards the middle region of human MTUS1

Sequence: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSG SFPSPSISPR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MTUS1 antibody concentration is 1 mg/ml.

Description: MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.

Characteristics: Antigen Size: 1270 amino acids

Molecular Weight: 141kDa

Application Details

Application Notes: WB Suggested Anti-MTUS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-MTUS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate

anti-Microtubule Associated Tumor Suppressor 1 (MTUS1) antibody (Image 2)

anti-Microtubule Associated Tumor Suppressor 1 (MTUS1) antibody (Image 3)

Publications

Product: Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).