Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502542

Family with Sequence Similarity 26, Member F (FAM26F) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf187, dJ93H18.5, A630077B13Rik, RGD1304835
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502542
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM26F antibody: synthetic peptide directed towards the middle region of human FAM26F
Sequence NRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILI AVVIIILLIF
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against FAM26F. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM26F
Background The function of this protein remains unknown.
Molecular Weight 34kDa
Gene ID 441168
NCBI Accession NP_001010919, NM_001010919
UniProt Q5R3K3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM26F antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 26, Member F (FAM26F)", type "Antibodies"
Hosts (4)
Reactivities (3)
Applications (4), (1)
Epitopes (2), (2), (1)
Beacon