Sterol-C5-Desaturase (ERG3 delta-5-Desaturase Homolog, S. Cerevisiae)-Like (SC5DL) antibody

Antigen: Sterol-C5-Desaturase (ERG3 delta-5-Desaturase Homolog, S. Cerevisiae)-Like (SC5DL)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502559

Additional Information

Alternative name: SC5DL

Gene ID: SC5DL

UniProt: O75845

Immunogen: The immunogen for anti-SC5DL antibody: synthetic peptide directed towards the N terminal of human SC5DL

Sequence: NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLG EFPYGLFELV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SC5DL antibody concentration is 1 mg/ml.

Description: SC5DL catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol.This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.

Characteristics: Antigen Size: 299 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-SC5DL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-SC5DL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate

Publications

Product: Krakowiak, Wassif, Kratz et al.: "Lathosterolosis: an inborn error of human and murine cholesterol synthesis due to lathosterol 5-desaturase deficiency." in: Human molecular genetics, Vol. 12, Issue 13, pp. 1631-41, 2003 (PubMed).