Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4) antibody

Antigen: Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4)

Synonyms: FLJ14624, FLJ22153

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN502589

Additional Information

Alternative name: TMTC4

Gene ID: TMTC4

UniProt: Q5T4D3

Immunogen: The immunogen for anti-TMTC4 antibody: synthetic peptide directed towards the C terminal of human TMTC4

Sequence: NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYH GNLAVLYHRW

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMTC4 antibody concentration is 1 mg/ml.

Description: It belongs to the TMTC family. Its exact function remains unknown.

Characteristics: Antigen Size: 741 amino acids

Molecular Weight: 83kDa

Application Details

Application Notes: WB Suggested Anti-TMTC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMTC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).