Synaptophysin (SYP) antibody
| Antigen | Synaptophysin (SYP) |
| Synonyms | Syn, p38, AI848995, A230093K24Rik, Syp1, syp-A, xsypi, MGC86277, syp-B, xsypii, MGC86267 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN502628 |
| Quantity | 50 µg |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | Synaptophysin / SYP |
| Gene ID | SYP |
| UniProt | B2R7L6 |
| Immunogen | The immunogen for anti-SYP antibody: synthetic peptide directed towards the N terminal of human SYP |
| Sequence | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFA FATCGSYSGE |
| Cross-Reactivity | Cow (Bovine), Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-SYP antibody concentration is 1 mg/ml. |
| Description | Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells. Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Characteristics | Antigen Size: 313 amino acids |
| Molecular Weight | 34kDa |
Application Details
| Application Notes |
WB Suggested Anti-SYP Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-SYP Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T anti-Synaptophysin (SYP) antibody (Image 2) |
Publications
| Product |
Glantz, Gilmore, Hamer et al.: "Synaptophysin and postsynaptic density protein 95 in the human prefrontal cortex from mid-gestation into early adulthood." in: Neuroscience, Vol. 149, Issue 3, pp. 582-91, 2007 (PubMed).
|
Alternatives
Alternatives for antigen "Synaptophysin (SYP)", type "Antibodies"
| Hosts | Rabbit (81), Mouse (63), Sheep (6) |
| Reactivities | Human (106), Rat (Rattus) (41), Mouse (Murine) (22), Cow (Bovine) (16), Pig (Porcine) (3), Chicken (2), Hamster (2), Monkey (2), Cat (Feline) (1), Guinea Pig (1) |
| Applications | Western Blotting (WB) (95), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (74), Immunohistochemistry (IHC) (40), ELISA (36), Immunohistochemistry (Fixed) (IHC (fx)) (21), Immunohistochemistry (Frozen Sections) (IHC (fro)) (14), Immunofluorescence (IF) (13), Immunocytochemistry (ICC) (10), Flow Cytometry (FACS) (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (4), Immunoprecipitation (IP) (4), Dot Blot (Dot) (1), Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (ffpe)) (1) |
| Conjugates | FITC (4), Biotin (3) |
| Epitopes | C-Term (12), N-Term (6), Internal Region (5), Tyr81 (2), pTyr81 (2), AA 245-258 (1), AA 41-62 (1), Center (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
