Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 21 Open Reading Frame 56 (C21orf56) antibody

Antigen

Chromosome 21 Open Reading Frame 56 (C21orf56)

Synonyms MGC99490, DKFZp434N0650
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502685
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C21orf56
Gene ID C21orf56
Immunogen The immunogen for anti-C21orf56 antibody: synthetic peptide directed towards the N terminal of human C21orf56
Sequence MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDAR VVGEIAFQLD
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C21orf56 antibody concentration is 1 mg/ml.
Description The specific function of C21orf56 is not yet known.
Characteristics Antigen Size: 186 amino acids
Molecular Weight 21kDa

Application Details

Application Notes WB Suggested Anti-C21orf56 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 21 Open Reading Frame 56 (C21orf56)", type "Antibodies"
Hosts Rabbit (23), Mouse (2)
Reactivities Human (23), Cow (Bovine) (19), Mouse (Murine) (19), Rat (Rattus) (19), Dog (Canine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (10), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Flow Cytometry (FACS) (2), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (1), N-Term (1)