Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502729

PPPDE Peptidase Domain Containing 2 (PPPDE2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms D15Wsu75e, DESI2, DJ347H13.4, DeSI-1, FAM152B, PPPDE2, AI427858, AI850401, Fam152b, Pppde2, RGD1305776, fam152b, pppde2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502729
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-D15Wsu75e antibody: synthetic peptide directed towards the middle region of human D15Wsu75e
Sequence FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPG GSSVGRPNGQ
Characteristics This is a rabbit polyclonal antibody against D15Wsu75e. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name D15Wsu75e
Background The function of this protein remains unknown.
Molecular Weight 18kDa
Gene ID 27351
NCBI Accession NP_056519, NM_015704
UniProt Q6ICB0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-D15Wsu75e antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "PPPDE Peptidase Domain Containing 2 (PPPDE2)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon