Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 9 Open Reading Frame 4 (C9orf4) antibody

Antigen

Chromosome 9 Open Reading Frame 4 (C9orf4)

Synonyms CG6, CG-6
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502792
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C9orf4
Gene ID C9orf4
UniProt Q9P0K9
Immunogen The immunogen for anti-C9orf4 antibody: synthetic peptide directed towards the middle region of human C9orf4
Sequence HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVT CRFKRPVNVP
Cross-Reactivity Human, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C9orf4 antibody concentration is 1 mg/ml.
Description The exact function of C9orf4 remains unknown.
Characteristics Antigen Size: 344 amino acids
Molecular Weight 37kDa

Application Details

Application Notes WB Suggested Anti-C9orf4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 9 Open Reading Frame 4 (C9orf4)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Rat (Rattus) (19), Cow (Bovine) (1), Mouse (Murine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (1), N-Term (1)