Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502811

Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SDR32C1, BC003479, C79874, C80074, PexRAP, RGD1311243, zgc:112518, MGC154832, MGC146711, DKFZp469I0533
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502811
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DHRS7B antibody: synthetic peptide directed towards the middle region of human DHRS7B
Sequence QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGS RYGVMDTTTA
Predicted Reactivity Human : 100%, Guinea pig : 92%, Rabbit : 92%, Rat : 92%, Dog : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against DHRS7B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DHRS7B
Background This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
Molecular Weight 35kDa
Gene ID 25979
NCBI Accession NP_056325, NM_015510
UniProt Q6IAN0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DHRS7B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B)", type "Antibodies"
Hosts (17), (2)
Reactivities (18), (12), (12), (12), (12)
Applications (10), (10), (4), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1)
Beacon