Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B) (Middle Region) antibody

Details for Product No. ABIN502811
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SDR32C1, BC003479, C79874, C80074, PexRAP, RGD1311243, zgc:112518, MGC154832, MGC146711, DKFZp469I0533
Epitope
Middle Region
(2), (1), (1)
Reactivity
Human
(16), (12), (12), (12), (12)
Host
Rabbit
(15), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (8), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN502811
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DHRS7B
Sequence QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGS RYGVMDTTTA
Predicted Reactivity Human : 100 %, Guinea pig : 90 %, Rabbit : 90 %, Rat : 90 %, Dog : 80 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against DHRS7B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DHRS7B
Background This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
Molecular Weight 35 kDa
Gene ID 25979
NCBI Accession NM_015510, NP_056325
UniProt Q6IAN0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 325 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B) (Middle Region) antibody WB Suggested Anti-DHRS7B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Hosts (15), (2)
Reactivities (16), (12), (12), (12), (12)
Applications (10), (8), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
back to top