Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B) antibody

Antigen: Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B)

Synonyms: CGI-93, MGC8916, SDR32C1, DKFZp566O084, C79874, C80074, MGC6908, BC003479, MGC105547, RGD1311243, MGC127349, zgc:112518, MGC154832, MGC146711, DKFZp469I0533

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502811

Additional Information

Alternative name: DHRS7B

Gene ID: DHRS7B

UniProt: Q6IAN0

Immunogen: The immunogen for anti-DHRS7B antibody: synthetic peptide directed towards the middle region of human DHRS7B

Sequence: QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGS RYGVMDTTTA

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DHRS7B antibody concentration is 1 mg/ml.

Description: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.

Characteristics: Antigen Size: 325 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-DHRS7B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DHRS7B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080 cell lysate

Publications

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).