Transmembrane Protein 206 (C1orf75) (N-Term) antibody

Details for Product No. ABIN502837
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf75, RP11-384C4.5, 2310028N02Rik, AI118576, RGD1359339, C16H1orf75
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Catalog no. ABIN502837
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C1orf75
Sequence IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDR YDAPGIALYP
Predicted Reactivity Human, Dog (Canine), Pig (Porcine), Horse (Equine), Rabbit, Cow (Bovine), Rat (Rattus), Mouse (Murine), Guinea Pig
Characteristics This is a rabbit polyclonal antibody against C1orf75. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C1orf75
Background The function of this protein remains unknown.
Molecular Weight 40 kDa
Gene ID 55248
NCBI Accession NM_018252, NP_060722
UniProt Q9H813
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 350 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1...." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (2), (1)
Reactivities (2)
Applications (3), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top