Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502837

Transmembrane Protein 206 (C1orf75) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf75, RP11-384C4.5, 2310028N02Rik, AI118576, RGD1359339, C16H1orf75
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502837
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C1orf75 antibody: synthetic peptide directed towards the N terminal of human C1orf75
Sequence IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDR YDAPGIALYP
Characteristics This is a rabbit polyclonal antibody against C1orf75. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C1orf75
Background The function of this protein remains unknown.
Molecular Weight 40kDa
Gene ID 55248
NCBI Accession NP_060722, NM_018252
UniProt Q9H813
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C1orf75 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Transmembrane Protein 206 (C1orf75)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon