Zinc Finger Protein 37A (ZNF37A) antibody

Antigen: Zinc Finger Protein 37A (ZNF37A)

Synonyms: ZNF37A

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB)

Catalog no.: ABIN502847

Additional Information

Alternative name: ZNF37A

Gene ID: ZNF37A

UniProt: P17032

Immunogen: The immunogen for anti-ZNF37A antibody: synthetic peptide directed towards the C terminal of human ZNF37A

Sequence: LIKHQRIHTGEKPYECNECGKSFSEKSTLTKHLRTHTGEK PYECIQCGKF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF37A antibody concentration is 1 mg/ml.

Description: ZNF37A belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Characteristics: Antigen Size: 561 amino acids

Molecular Weight: 65kDa

Application Details

Application Notes: WB Suggested Anti-ZNF37A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF37A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Publications

Product: Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).