Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Empty Spiracles Homeobox 1 (EMX1) antibody

Antigen

Empty Spiracles Homeobox 1 (EMX1)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish, Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502853
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name EMX1
Gene ID EMX1
UniProt Q04741
Immunogen The immunogen for anti-EMX1 antibody: synthetic peptide directed towards the middle region of human EMX1
Sequence DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVG AERKQLAGSL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-EMX1 antibody concentration is 1 mg/ml.
Description EMX1 belongs to the EMX homeobox family.It is transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. The protein may function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
Characteristics Antigen Size: 290 amino acids
Molecular Weight 31kDa

Application Details

Application Notes WB Suggested Anti-EMX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives

Alternatives for antigen "Empty Spiracles Homeobox 1 (EMX1)", type "Antibodies"
Hosts Rabbit (32), Chicken (3)
Reactivities Human (34), Mouse (Murine) (29), Rat (Rattus) (27), Dog (Canine) (19), Chicken (18), Cow (Bovine) (18), Horse (Equine) (18), Pig (Porcine) (18), Rabbit (18), Sheep (Ovine) (18), Fruit Fly (Drosophila melanogaster) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (20), Immunofluorescence (IF) (15), ELISA (13), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (7), Internal Region (3), N-Term (2), Middle Region (1)