Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

UNC Homeobox (UNCX) antibody

Antigen

UNC Homeobox (UNCX)

Synonyms UNCX4.1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502854
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name UNCX
Gene ID UNCX
UniProt A6NJT0
Immunogen The immunogen for anti-UNCX antibody: synthetic peptide directed towards the N terminal of human UNCX
Sequence LLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFT GWQLEELEKA
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-UNCX antibody concentration is 1 mg/ml.
Description UNCX is a transcription factor involved in somitogenesis and neurogenesis. It is required for the maintenance and differentiation of particular elements of the axial skeleton. It may act upstream of PAX9. UNCX plays a role in controlling the development of connections of hypothalamic neurons to pituitary elements, allowing central neurons to reach the peripheral blood circulation and to deliver hormones for control of peripheral functions.
Characteristics Antigen Size: 531 amino acids
Molecular Weight 54kDa

Application Details

Application Notes WB Suggested Anti-UNCX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).

Alternatives

Alternatives for antigen "UNC Homeobox (UNCX)", type "Antibodies"
Hosts Rabbit (26), Mouse (2)
Reactivities Human (25), Chicken (18), Dog (Canine) (18), Mouse (Murine) (18), Pig (Porcine) (18), Rat (Rattus) (18), Zebrafish (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (11), ELISA (7), Immunohistochemistry (IHC) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunostaining (ISt) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (3), N-Term (2)