Zinc Finger Protein 93 (ZNF93) (N-Term) antibody

Details for Product No. ABIN502882
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms TF34, HPF34, HTF34, ZNF505
Epitope
N-Term
(3), (3)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Human
(6), (1), (1), (1), (1), (1)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6)
Pubmed 1 reference available
Catalog no. ABIN502882
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF93
Sequence FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKR IHTGEKPYKC
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF93. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF93
Background ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 71 kDa
Gene ID 81931
NCBI Accession NM_031218, NP_112495
UniProt P35789
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 620 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 93 (ZNF93) (N-Term) antibody WB Suggested Anti-ZNF93 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Hosts (6)
Reactivities (6), (1), (1), (1), (1), (1)
Applications (6)
Epitopes (3), (3)
back to top