Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502882

Zinc Finger Protein 93 (ZNF93) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TF34, HPF34, HTF34, ZNF505
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502882
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF93 antibody: synthetic peptide directed towards the N terminal of human ZNF93
Sequence FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKR IHTGEKPYKC
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF93. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF93
Background ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 71kDa
Gene ID 81931
NCBI Accession NP_112495, NM_031218
UniProt P35789
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF93 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 93 (ZNF93)", type "Antibodies"
Hosts (5)
Reactivities (5), (1), (1), (1), (1), (1)
Applications (5), (1)
Epitopes (3), (2)
Beacon