Zinc Finger Protein 93 (ZNF93) antibody

Antigen: Zinc Finger Protein 93 (ZNF93)

Synonyms: TF34, HPF34, HTF34, ZNF505

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN502882

Additional Information

Alternative name: ZNF93

Gene ID: ZNF93

UniProt: P35789

Immunogen: The immunogen for anti-ZNF93 antibody: synthetic peptide directed towards the N terminal of human ZNF93

Sequence: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKR IHTGEKPYKC

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF93 antibody concentration is 1 mg/ml.

Description: ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Characteristics: Antigen Size: 620 amino acids

Molecular Weight: 71kDa

Application Details

Application Notes: WB Suggested Anti-ZNF93 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF93 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate

Publications

Product: Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).