Zinc Finger Protein 169 (ZNF169) antibody

Antigen: Zinc Finger Protein 169 (ZNF169)

Synonyms: MGC51961, Znf169, ZNF169

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502895

Additional Information

Alternative name: ZNF169

Gene ID: ZNF169

UniProt: Q14929

Immunogen: The immunogen for anti-ZNF169 antibody: synthetic peptide directed towards the N terminal of human ZNF169

Sequence: EPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQY ALSGHPTQIF

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF169 antibody concentration is 1 mg/ml.

Description: ZNF169 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 603 amino acids

Molecular Weight: 68kDa

Application Details

Application Notes: WB Suggested Anti-ZNF169 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human kidney.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF169 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human kidney

Publications

Product: Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).