Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11) antibody

Antigen

Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11)
Synonyms MDT1, CGI82, PSDR1, RALR1, SCALD, ARSDR1, HCBP12, SDR7C1, FLJ32633, RDH11, DKFZp468M1528
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502935
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name RDH11
Gene ID RDH11
UniProt Q8TC12
Immunogen The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11
Sequence SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVS AQARNETIAR
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RDH11 antibody concentration is 1 mg/ml.
Description RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.[supplied by OMIM].
Characteristics Antigen Size: 318 amino acids
Molecular Weight 35kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-RDH11 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Signaling, Metabolism, Cancer
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Roni, Carpio, Wissinger: "Mapping of transcription start sites of human retina expressed genes." in: BMC genomics, Vol. 8, pp. 42, 2007 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11)", type "Antibodies"
Hosts Rabbit (39), Mouse (2)
Reactivities Human (37), Mouse (Murine) (23), Rat (Rattus) (21), Dog (Canine) (18), Horse (Equine) (18), Pig (Porcine) (18), Sheep (Ovine) (18)
Applications Western Blotting (WB) (25), ELISA (16), Immunofluorescence (IF) (16), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Flow Cytometry (FACS) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (8), C-Term (3)