Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SET and MYND Domain Containing 2 (SMYD2) antibody

Antigen

SET and MYND Domain Containing 2 (SMYD2)
Synonyms KMT3C, HSKM-B, ZMYND14, MGC119305, Zmynd14, 4930402C15, 1110020E07Rik, MGC52800, smyd2, im:7146196, wu:fc02f02, zgc:110553, MGC143150
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502963
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-SET and MYND Domain Containing 2 (SMYD2) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name SMYD2
Gene ID SMYD2
UniProt Q9NRG4
Immunogen The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the N terminal of human SMYD2
Sequence RLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKK DLIQSDIAAL
Cross-Reactivity Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SMYD2 antibody concentration is 1 mg/ml.
Description The specific function of this protein remains unknown.
Characteristics Antigen Size: 433 amino acids
Molecular Weight 50kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-SMYD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Abu-Farha, Lambert, Al-Madhoun et al.: "The tale of two domains: proteomics and genomics analysis of SMYD2, a new histone methyltransferase." in: Molecular & cellular proteomics : MCP, Vol. 7, Issue 3, pp. 560-72, 2008 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "SET and MYND Domain Containing 2 (SMYD2)", type "Antibodies"
Hosts Rabbit (33)
Reactivities Human (32), Mouse (Murine) (21), Cow (Bovine) (19), Dog (Canine) (19), Pig (Porcine) (19), Rat (Rattus) (19), Chicken (1), Zebrafish (1)
Applications Western Blotting (WB) (17), Immunofluorescence (IF) (15), ELISA (13), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (3), C-Term (2), Internal Region (1)