N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) antibody

Antigen: N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16)

Synonyms: Narg1l, 1300019C06Rik, NARG1L, MGC40612, RP11-396A22.1, narg1, narg1l, MGC152570, ga19, nath, tbdn100, MGC135844

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN502996

Additional Information

Alternative name: NARG1L

Gene ID: NARG1L

UniProt: Q6N069

Immunogen: The immunogen for anti-NARG1L antibody: synthetic peptide directed towards the middle region of human NARG1L

Sequence: RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHS NLPDIVSKVL

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NARG1L antibody concentration is 1 mg/ml.

Description: NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

Characteristics: Antigen Size: 864 amino acids

Molecular Weight: 101kDa

Application Details

Application Notes: WB Suggested Anti-NARG1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NARG1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).