Did you know that you can buy products from over 140 different suppliers from us?

Transketolase-Like 2 (TKTL2) (N-Term) antibody

Details for Product No. ABIN503003
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TKTL2, 4933401I19Rik, RGD1304767
Epitope
N-Term
(7), (7), (2), (2), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(15), (1), (1), (1), (1), (1)
Host
Rabbit
(14), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (8), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503003
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TKTL2
Sequence QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRG HAAPILYAAW
Predicted Reactivity Human : 100 %, Guinea pig : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against TKTL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TKTL2
Background The exact function of TCP10 remains unknown.
Molecular Weight 68 kDa
Gene ID 84076
NCBI Accession NM_032136, NP_115512
UniProt Q9H0I9
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 626 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Validation Images
back to top