Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503011

Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FLH21957, HGK, MEKKK4, NIK, 9430080K19Rik, AU043147, AU045934, AW046177, Nik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Pig (Porcine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN503011
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4
Sequence PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGS EEEEEEVPEQ
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against MAP4K4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAP4K4
Background MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight 133kDa
Gene ID 9448
NCBI Accession NP_004825, NM_004834
UniProt O95819
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAP4K4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bouzakri, Zierath: "MAP4K4 gene silencing in human skeletal muscle prevents tumor necrosis factor-alpha-induced insulin resistance." in: The Journal of biological chemistry, Vol. 282, Issue 11, pp. 7783-9, 2007 (PubMed).

Alternatives for antigen "Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4)", type "Antibodies"
Hosts (93), (26)
Reactivities (118), (62), (50), (48), (48), (12), (12), (1)
Applications (65), (48), (40), (25), (10), (9), (3), (3), (1)
Conjugates (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Epitopes (16), (15), (12), (6), (5), (5), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon