Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4) antibody

Antigen

Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4)

Synonyms HGK, NIK, FLH21957, FLJ10410, FLJ20373, FLJ90111, KIAA0687
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken, Zebrafish, Pig (Porcine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN503011
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MAP4K4
Gene ID MAP4K4
Immunogen The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4
Sequence PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGS EEEEEEVPEQ
Cross-Reactivity Cow (Bovine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MAP4K4 antibody concentration is 1 mg/ml.
Description MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified.
Characteristics Antigen Size: 1166 amino acids
Molecular Weight 133kDa

Application Details

Application Notes WB Suggested Anti-MAP4K4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Small Intestine.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Signaling
Restrictions For Research Use only

Publications

Product Bouzakri, Zierath: "MAP4K4 gene silencing in human skeletal muscle prevents tumor necrosis factor-alpha-induced insulin resistance." in: The Journal of biological chemistry, Vol. 282, Issue 11, pp. 7783-9, 2007 (PubMed).

Alternatives

Alternatives for antigen "Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4)", type "Antibodies"
Hosts Rabbit (59), Mouse (12)
Reactivities Human (69), Mouse (Murine) (37), Chicken (19), Cow (Bovine) (19), Dog (Canine) (19), Horse (Equine) (19), Pig (Porcine) (19), Rat (Rattus) (19)
Applications Immunofluorescence (IF) (35), ELISA (28), Western Blotting (WB) (28), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (9), Dot Blot (Dot) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (4), Alexa Fluor 488 (4), Alexa Fluor 555 (4), Alexa Fluor 647 (4), PE,Cy5.5 (4), Alexa Flour 488 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1)
Epitopes pSer631 (7), pSer629 (6), pSer801 (6), AA 400-500 (3), AA 931-947 (2), C-Term (1), Center (1), Internal Region (1), N-Term (1), pSer63 (1), pTyr1238 (1)