Protocadherin alpha 10 (PCDHA10) antibody

Antigen: Protocadherin alpha 10 (PCDHA10)

Synonyms: CNR8, CNRN8, CNRS8, CRNR8, PCDH-ALPHA10

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503032

Additional Information

Alternative name: PCDHA10

Gene ID: PCDHA10

UniProt: Q9Y5I2-3

Immunogen: The immunogen for anti-PCDHA10 antibody: synthetic peptide directed towards the N terminal of human PCDHA10

Sequence: ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDII NKKDKDKFPV

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PCDHA10 antibody concentration is 1 mg/ml.

Description: This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Characteristics: Antigen Size: 844 amino acids

Molecular Weight: 89kDa

Application Details

Application Notes: WB Suggested Anti-PCDHA10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-PCDHA10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach

Publications

Product: Schmutz, Martin, Terry et al.: "The DNA sequence and comparative analysis of human chromosome 5." in: Nature, Vol. 431, Issue 7006, pp. 268-74, 2004 (PubMed).