PCDHA10 antibody (N-Term)

Catalog No. ABIN634738

Product Details anti-PCDHA10 Antibody

Target: PCDHA10 (Protocadherin alpha 10 (PCDHA10))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHA10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHA10 antibody was raised against the N terminal of PCDHA10

Purification: Affinity purified

Immunogen: PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHA10 Blocking Peptide, catalog no. 33R-2743, is also available for use as a blocking control in assays to test for specificity of this PCDHA10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHA10

Target: PCDHA10 (Protocadherin alpha 10 (PCDHA10))

Alternative Name: PCDHA10 (PCDHA10 Products)

Synonyms: CNR8 antibody, CNRN8 antibody, CNRS8 antibody, CRNR8 antibody, PCDH-ALPHA10 antibody, Cnr3 antibody, Cnr8 antibody, Crnr3 antibody, Crnr8 antibody, Pcdha14 antibody, rCNRv10 antibody, protocadherin alpha 10 antibody, PCDHA10 antibody, Pcdha10 antibody

Background: This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster.

Molecular Weight: 89 kDa (MW of target protein)