Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10) antibody

Antigen

DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10)
Synonyms JPDI, ERdj5, D2Ertd706e, 1200006L06Rik, DNAJC10, dnajc10, MGC162218, zgc:162218, MGC152508, DKFZp469N0614, MGC104194, DKFZp434J1813
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503035
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name DNAJC10 / ERDJ5
Gene ID DNAJC10
UniProt Q8IXB1
Immunogen The immunogen for anti-DNAJC10 antibody: synthetic peptide directed towards the N terminal of human DNAJC10
Sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAH GDFLKINRAY
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-DNAJC10 antibody concentration is 1 mg/ml.
Description This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
Characteristics Antigen Size: 793 amino acids
Molecular Weight 91kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-DNAJC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: ACHN cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10)", type "Antibodies"
Hosts Rabbit (25), Mouse (3)
Reactivities Human (27), Mouse (Murine) (21), Rat (Rattus) (21), Chicken (19), Cow (Bovine) (19), Dog (Canine) (19), Horse (Equine) (18), Cat (Feline) (1)
Applications Immunofluorescence (IF) (18), Western Blotting (WB) (13), ELISA (12), Immunohistochemistry (IHC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (1)