Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503036

Smith-Magenis Syndrome Chromosome Region, Candidate 7-Like (SMCR7L) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSU79252, MID51, MIEF1, dJ1104E15.3, A230016E22, AI452372, MGC115280
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503036
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SMCR7L antibody: synthetic peptide directed towards the N terminal of human SMCR7L
Sequence GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEP NWMGSPRLLN
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against SMCR7L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SMCR7L
Background The specific function of this protein remains unknown.
Molecular Weight 51kDa
Gene ID 54471
NCBI Accession NP_061881, NM_019008
UniProt Q9NQG6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SMCR7L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Smith-Magenis Syndrome Chromosome Region, Candidate 7-Like (SMCR7L)", type "Antibodies"
Hosts (9), (1)
Reactivities (9), (5), (2)
Applications (9), (2), (2), (1)
Epitopes (4), (2), (1), (1)
Beacon