Smith-Magenis Syndrome Chromosome Region, Candidate 7-Like (SMCR7L) (N-Term) antibody

Details for Product No. ABIN503036
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSU79252, MID51, MIEF1, dJ1104E15.3, A230016E22, AI452372, MGC115280
Epitope
N-Term
(3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(10), (5), (3)
Host
Rabbit
(10), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503036
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SMCR7L
Sequence GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEP NWMGSPRLLN
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against SMCR7L. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SMCR7L
Background The specific function of this protein remains unknown.
Molecular Weight 51 kDa
Gene ID 54471
NCBI Accession NM_019008, NP_061881
UniProt Q9NQG6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 463 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Smith-Magenis Syndrome Chromosome Region, Candidate 7-Like (SMCR7L) (N-Term) antibody WB Suggested Anti-SMCR7L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080 cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (10), (1)
Reactivities (10), (5), (3)
Applications (11), (2), (2), (1)
Epitopes (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top