Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503042

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 19 (CEACAM19) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CEAL1, C130022P09Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503042
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CEACAM19 antibody: synthetic peptide directed towards the middle region of human CEACAM19
Sequence MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKE LPSTHLPTNA
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against CEACAM19. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CEACAM19
Background The specific function of the protein remains unknown.
Molecular Weight 33kDa
Gene ID 56971
NCBI Accession NP_064604, NM_020219
UniProt Q7Z692
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CEACAM19 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Carcinoembryonic Antigen-Related Cell Adhesion Molecule 19 (CEACAM19)", type "Antibodies"
Hosts (18), (1), (1)
Reactivities (19), (16), (16), (16)
Applications (16), (9), (4), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon