Transmembrane Protein 63C (TMEM63C) antibody

Antigen: Transmembrane Protein 63C (TMEM63C)

Synonyms: C14orf171, 4932420N09, 9330187M14Rik, RGD1310207, DKFZp468A1211

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503044

Additional Information

Alternative name: TMEM63C

Gene ID: TMEM63C

UniProt: Q9P1W3

Immunogen: The immunogen for anti-TMEM63C antibody: synthetic peptide directed towards the middle region of human TMEM63C

Sequence: EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPAS SPARHTYGTM

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMEM63C antibody concentration is 1 mg/ml.

Description: The specific function of the protein remains unknown.

Characteristics: Antigen Size: 806 amino acids

Molecular Weight: 93kDa

Application Details

Application Notes: WB Suggested Anti-TMEM63C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM63C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate

Publications

Product: Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).