TMEM63C antibody (Middle Region)

Catalog No. ABIN635467

Product Details anti-TMEM63C Antibody

Target: TMEM63C (Transmembrane Protein 63C (TMEM63C))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM63C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM63 C antibody was raised against the middle region of TMEM63

Purification: Affinity purified

Immunogen: TMEM63 C antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM63C Blocking Peptide, catalog no. 33R-2348, is also available for use as a blocking control in assays to test for specificity of this TMEM63C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM63C

Target: TMEM63C (Transmembrane Protein 63C (TMEM63C))

Alternative Name: TMEM63C (TMEM63C Products)

Synonyms: DKFZp468A1211 antibody, C14orf171 antibody, 4932420N09 antibody, 9330187M14Rik antibody, RGD1310207 antibody, transmembrane protein 63C antibody, transmembrane protein 63c antibody, TMEM63C antibody, tmem63c antibody, Tmem63c antibody

Background: The function of TMEM63C protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 93 kDa (MW of target protein)