ADAM Metallopeptidase Domain 30 (ADAM30) (N-Term) antibody

Details for Product No. ABIN503056
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms svph4, 4933424D07Rik
Epitope
N-Term
(3), (2), (1)
Reactivity
Human
(8), (1)
Host
Rabbit
(8), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503056
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ADAM30
Sequence IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRF VNNNLSQVIH
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ADAM30. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ADAM30
Background ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involvi
Molecular Weight 66 kDa
Gene ID 11085
NCBI Accession NM_021794, NP_068566
UniProt Q9UKF2
Research Area Proteolysis / Ubiquitin, Metalloprotease, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 790 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ADAM Metallopeptidase Domain 30 (ADAM30) (N-Term) antibody WB Suggested Anti-ADAM30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1...." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (8), (2)
Reactivities (8), (1)
Applications (6), (4), (2), (1)
Epitopes (3), (2), (1)
back to top