Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503056

ADAM Metallopeptidase Domain 30 (ADAM30) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms svph4, 4933424D07Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503056
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ADAM30 antibody: synthetic peptide directed towards the N terminal of human ADAM30
Sequence IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRF VNNNLSQVIH
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ADAM30. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ADAM30
Background ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involvi
Molecular Weight 66kDa
Gene ID 11085
NCBI Accession NP_068566, NM_021794
UniProt Q9UKF2
Research Area Proteolysis / Ubiquitin, Metalloprotease, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ADAM30 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "ADAM Metallopeptidase Domain 30 (ADAM30)", type "Antibodies"
Hosts (8), (2)
Reactivities (8), (1)
Applications (6), (6), (2), (1)
Epitopes (3), (2), (1)
Beacon