ADAM Metallopeptidase Domain 30 (ADAM30) antibody

Antigen: ADAM Metallopeptidase Domain 30 (ADAM30)

Synonyms: svph4, MGC132801, MGC132802, 4933424D07Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503056

Additional Information

Alternative name: ADAM30

Gene ID: ADAM30

UniProt: Q9UKF2

Immunogen: The immunogen for anti-ADAM30 antibody: synthetic peptide directed towards the N terminal of human ADAM30

Sequence: IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRF VNNNLSQVIH

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ADAM30 antibody concentration is 1 mg/ml.

Description: ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involvi

Characteristics: Antigen Size: 790 amino acids

Molecular Weight: 66kDa

Application Details

Application Notes: WB Suggested Anti-ADAM30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin, Metalloprotease, Extracellular Matrix

Restrictions: For Research Use only

Images

WB Suggested Anti-ADAM30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).