Transmembrane Protein 135 (TMEM135) antibody

Antigen: Transmembrane Protein 135 (TMEM135)

Synonyms: FLJ22104, DKFZp686I1974, AW319712, 2810439K08Rik, RGD1309948, MGC80368, MGC127525, im:6901522, zgc:162425

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN503077

Additional Information

Alternative name: TMEM135

Gene ID: TMEM135

UniProt: Q86UB9

Immunogen: The immunogen for anti-TMEM135 antibody: synthetic peptide directed towards the N terminal of human TMEM135

Sequence: SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTA NGALYMAFFC

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMEM135 antibody concentration is 1 mg/ml.

Description: The exact function of TMEM135 remains unknown.

Characteristics: Antigen Size: 458 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-TMEM135 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM135 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).