Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Dehydrogenase/reductase (SDR Family) Member 11 (DHRS11) antibody

Antigen

Dehydrogenase/reductase (SDR Family) Member 11 (DHRS11)

Synonyms RGD1307935, MGC128255
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503092
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name DHRS11
Gene ID MGC4172
UniProt Q6UWP2
Immunogen The immunogen for anti-MGC4172 antibody: synthetic peptide directed towards the middle region of human MGC4172
Sequence DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQ ELREAQTHIR
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MGC4172 antibody concentration is 1 mg/ml.
Description The function of this protein remains unknown.
Characteristics Antigen Size: 260 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-MGC4172 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Spleen.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives

Alternatives for antigen "Dehydrogenase/reductase (SDR Family) Member 11 (DHRS11)", type "Antibodies"
Hosts Rabbit (10)
Reactivities Human (8), Mouse (Murine) (5), Rat (Rattus) (4), Chicken (2), Cow (Bovine) (2), Cat (Feline) (1), Dog (Canine) (1), Xenopus laevis (1)
Applications Western Blotting (WB) (9), ELISA (7), Immunohistochemistry (IHC) (2), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Epitopes Internal Region,AA 114-142 (1)