Did you know that you can buy products from over 140 different suppliers from us?

Thioredoxin Domain Containing 15 (TXNDC15) (C-Term) antibody

Details for Product No. ABIN503097
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C5orf14, UNQ335, 2310047H23Rik, AI854086, RGD1304696
Epitope
C-Term
(7), (7)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Human
(9)
Host
Rabbit
(9), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (6), (6), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503097
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TXNDC15
Sequence STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFN QTGIEAKKNV
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 100 %
Characteristics This is a rabbit polyclonal antibody against TXNDC15. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TXNDC15
Background TXNDC15 is a single-pass type I membrane protein. It contains 1 thioredoxin domain.
Molecular Weight 40 kDa
Gene ID 79770
NCBI Accession NM_024715, NP_078991
UniProt Q96J42
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 360 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Validation Images
back to top