Zinc Finger Protein 429 (ZNF429) antibody

Antigen: Zinc Finger Protein 429 (ZNF429)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503144

Additional Information

Alternative name: ZNF429

Gene ID: ZNF429

UniProt: Q86V71

Immunogen: The immunogen for anti-ZNF429 antibody: synthetic peptide directed towards the N terminal of human ZNF429

Sequence: KMYHCDIYVKVFYAFSNADRYKTRHTGKKPFQCKKCGKSF CMLSQLTQHK

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF429 antibody concentration is 1 mg/ml.

Description: ZNF429 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 674 amino acids

Molecular Weight: 78kDa

Application Details

Application Notes: WB Suggested Anti-ZNF429 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF429 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Publications

Product: Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).