Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503146

Protein ZNF783 (ZNF783) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503146
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF783 antibody: synthetic peptide directed towards the middle region of human ZNF783
Sequence EVGRPRMMGTGLPPYPEHLTSPLSPAQEELKEGQAPKQQQ DSEARVAPAG
Predicted Reactivity Human : 100%, Dog : 78%
Characteristics This is a rabbit polyclonal antibody against ZNF783. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF783
Background The specific function of this protein remains unknown.
Molecular Weight 61kDa
Gene ID 155060
NCBI Accession NP_001004302, NM_001004302
UniProt C9J9J2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF783 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Protein ZNF783 (ZNF783)", type "Antibodies"
Hosts (5), (2)
Reactivities (7), (2)
Applications (7), (2)
Epitopes (3), (3), (2), (1)
Beacon