Zinc Finger Protein 793 (ZNF793) (Middle Region) antibody

Details for Product No. ABIN503149
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(1), (1)
Reactivity
Human
(3)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 2 references available
Catalog no. ABIN503149
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF793
Sequence FCGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYL NVHRKMHTGE
Predicted Reactivity Horse : 100 %, Human : 100 %, Rabbit : 100 %, Bovine : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF793. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF793
Background ZNF793 may be involved in transcriptional regulation.
Molecular Weight 47 kDa
Gene ID 390927
NCBI Accession NM_001013659, NP_001013681
UniProt Q6ZN11
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 406 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 793 (ZNF793) (Middle Region) antibody WB Suggested Anti-ZNF793 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (3)
Reactivities (3)
Applications (3)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top